PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10013308m
Common NameCARUB_v10012991mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 585aa    MW: 67479.8 Da    PI: 10.1443
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10013308mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57.4e-09221265246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+WT+ Ed+ l + +++ G  +W  Ia  +g++Rt+ qc  r+q 
  Carubv10013308m 221 GPWTEAEDKNLPRIIEEKGLTDWVEIAVSLGTNRTPFQCLARYQR 265
                      89*****************************************96 PP

2Myb_DNA-binding44.34e-14273317146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r+ WT+eEd++l  av+++G ++W ++a+ +  gR + qc +rw k
  Carubv10013308m 273 RKEWTPEEDDQLRAAVELFGDKDWQSVANVLK-GRAGTQCSNRWKK 317
                      789****************************9.***********98 PP

3Myb_DNA-binding53.84.3e-17324369147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +grW+ eEd++ + av+++G+ +W++I++ ++ gRt+ qc++rw + 
  Carubv10013308m 324 KGRWSLEEDKRVKVAVTLFGSQNWHKISQFVP-GRTATQCRERWVNC 369
                      79******************************.***********986 PP

4Myb_DNA-binding475.8e-15376420147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+WT+eEde+l++a+ ++G   W+++a+++   Rt++qc  rw ++
  Carubv10013308m 376 RGKWTEEEDEKLKEAIGKHGYS-WSKVASHLA-CRTDNQCLRRWKTL 420
                      89******************99.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.879121214IPR017877Myb-like domain
SMARTSM0071724125216IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-6128144IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-6190226IPR009057Homeodomain-like
SuperFamilySSF466893.34E-11213270IPR009057Homeodomain-like
PROSITE profilePS500909.291215267IPR017877Myb-like domain
SMARTSM007179.6E-10219269IPR001005SANT/Myb domain
PfamPF002492.6E-8221265IPR001005SANT/Myb domain
CDDcd001678.70E-6222267No hitNo description
Gene3DG3DSA:1.10.10.607.0E-15227275IPR009057Homeodomain-like
SuperFamilySSF466893.46E-20252322IPR009057Homeodomain-like
PROSITE profilePS5129422.559268323IPR017930Myb domain
SMARTSM007172.6E-13272321IPR001005SANT/Myb domain
PfamPF002493.3E-13273317IPR001005SANT/Myb domain
CDDcd001674.25E-10275319No hitNo description
Gene3DG3DSA:1.10.10.601.0E-16276322IPR009057Homeodomain-like
SMARTSM007175.2E-14323372IPR001005SANT/Myb domain
PROSITE profilePS5129413.459324370IPR017930Myb domain
PfamPF002493.4E-15324369IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-19325374IPR009057Homeodomain-like
CDDcd001673.47E-10326368No hitNo description
SuperFamilySSF466896.83E-26350425IPR009057Homeodomain-like
PROSITE profilePS5129427.078371425IPR017930Myb domain
SMARTSM007171.1E-13375423IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-20375421IPR009057Homeodomain-like
PfamPF002499.0E-14376420IPR001005SANT/Myb domain
CDDcd001671.63E-10378420No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 585 aa     Download sequence    Send to blast
MPAASSTFPE AAQAFVDAIR KNRAYQKFLR RKLEVIEATI EQNEKHRKNV KIVKDFQASC  60
KRRTKLALSQ RKDPRVELIS ARKCVPCDSS EGNDKKTSPL MLGPPENPFV AKYRMALEKY  120
PVSVERRNWS TEENKNLAKG LKQEVQKILL YEAIEQSRDL EDSTYDIDTI NESIRNLEIT  180
PEMIRQFLPK INWDSLDIKD RSAAECEARW MSSEDPLINH GPWTEAEDKN LPRIIEEKGL  240
TDWVEIAVSL GTNRTPFQCL ARYQRSLNPS ILRKEWTPEE DDQLRAAVEL FGDKDWQSVA  300
NVLKGRAGTQ CSNRWKKSLR PTRKGRWSLE EDKRVKVAVT LFGSQNWHKI SQFVPGRTAT  360
QCRERWVNCL EPKVNRGKWT EEEDEKLKEA IGKHGYSWSK VASHLACRTD NQCLRRWKTL  420
YPHQVVLLQQ ARRLRKEAIV GNFVDRESER PALVTGAILA LPEISLEPDP DSVALKNKRK  480
AKQRKSDAER QPKRRRKGLE KCSGDVIRQE NATVCEKEPN NGGEEKSLEL ERYNEIQDNA  540
KEKQRRSRKR VAETPNNTTG LRKLTPRRKK VSAVVPIKNQ DALN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-302004199159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-302004199159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1477495KRKAKQRKSDAERQPKRRR
2547569RKRVAETPNNTTGLRKLTPRRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0338270.0AY033827.1 Arabidopsis thaliana putative transcription factor (MYB4R1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006296998.10.0hypothetical protein CARUB_v10012991mg
TrEMBLR0G3G90.0R0G3G9_9BRAS; Uncharacterized protein
STRINGAT3G18100.10.0(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.10.0myb domain protein 4r1